PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00223.1.g00430.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HD-ZIP
Protein Properties Length: 889aa    MW: 94521.5 Da    PI: 9.9275
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00223.1.g00430.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox52.77.4e-17718772256
                                   T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
                      Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                                   rk+ +++keq   Lee F+++ +++ +++  LAk+l+L  rqV vWFqNrRa+ k
  Zpz_sc00223.1.g00430.1.am.mk 718 RKKLRLSKEQSAFLEENFKEHATLNPKQKLALAKQLNLRPRQVEVWFQNRRARTK 772
                                   788899***********************************************98 PP

2HD-ZIP_I/II123.31.2e-39718808192
                   HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLe 81 
                                   +kk+rlskeq+++LEe+F+e+ +L+p++K +la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+
  Zpz_sc00223.1.g00430.1.am.mk 718 RKKLRLSKEQSAFLEENFKEHATLNPKQKLALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQ 798
                                   69******************************************************************************* PP

                   HD-ZIP_I/II  82 keveeLreelk 92 
                                   ke +eLr +lk
  Zpz_sc00223.1.g00430.1.am.mk 799 KELAELR-ALK 808
                                   ******9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-16708773IPR009057Homeodomain-like
SuperFamilySSF466891.24E-17709775IPR009057Homeodomain-like
PROSITE profilePS5007117.022714774IPR001356Homeobox domain
SMARTSM003897.1E-15716778IPR001356Homeobox domain
CDDcd000862.76E-16718775No hitNo description
PfamPF000462.4E-14718772IPR001356Homeobox domain
PROSITE patternPS000270749772IPR017970Homeobox, conserved site
CDDcd146869.06E-4765806No hitNo description
PfamPF021834.2E-10774808IPR003106Leucine zipper, homeobox-associated
SMARTSM003401.5E-24774817IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 889 aa     Download sequence    Send to blast
MAISVATEAE RFFHGEKKKA GTYYSGSSDG DDERGPRFRF RSSGSGMLGP GMNDARGSPD  60
PLPFMGQGHE AEACGGQSRR NDCAWRTVGP TSSRHAGWAH ASSTPRAAHT EAGFPLVSSA  120
WVPIPLSCPG GPPSVLVSSA KPPLVCAVGA LGHGEIMGAC MQSYPDIVSR RPSPRHQIST  180
SRLSSGICSG LYRVLRPNGF IPLGFYSSYQ ASGTEEMDRG GWPTTGRDRP RSIRTHAARL  240
LAPVHHATSH TTATVSGFGG LLRGGIAIAS SSSSILGMGP PRALTPSTVT SPRRAAPRYT  300
VAADWRAGGG ARARTALAAC SRSICRCPCP LPPHASPVLP YGVDTRGALG PPCYCCILSR  360
SQRSYSNLRN LTTDGHAAVH VTPRRFKDTD WGGPMNLGAV AFTALRRPLH VMTSGSAAAR  420
ADLLGRKLGR ASCPAVCHHE ALLRRELEMQ GEEGHFPRRA SSPVLTHDIP LRFKLSDPAL  480
PFLPGHVRRV NRSNPPLSQA HTNTGREERV PGRLAPSCHA AAIKSRRPCE FRRFQYSTGR  540
MELGLSLGAT MADAGRDLVL GLGMGMGVSR REDEGAERRG KSDREEAAAA PARRELEFGA  600
GRCGRSSPEP PARLTFLSME PTLGLPWPSP DTGHLLASTR GFDVNRAPSC ATGAAGEEDD  660
ERDDAGAGGA AVSSSSPNNS AGSFPTDFSA RGQAGTGGRG GDRACSRASD EDDGGSSRKK  720
LRLSKEQSAF LEENFKEHAT LNPKQKLALA KQLNLRPRQV EVWFQNRRAR TKLKQTEVDC  780
EYLKRCCETL TEENRRLQKE LAELRALKTV NPFYMHLPAT TLSMCPSCER VSSNSATAPG  840
ASAPAAAPAL SSGGIGDAAP EQRPSSFAAL FSAPLHRPLA AQPQAPASS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1716722SRKKLRL
2766774RRARTKLKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0364470.0BT036447.1 Zea mays full-length cDNA clone ZM_BFb0114O05 mRNA, complete cds.
GenBankKJ7269110.0KJ726911.1 Zea mays clone pUT3456 HB transcription factor (HB11) mRNA, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP52093363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.14e-57homeobox from Arabidopsis thaliana